제품 > 항체 > 다중클론항체(pAb)

CD3EAP Rabbit pAb (A16099)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CD3EAP Rabbit pAb (A16099) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	CD3EAP Rabbit pAb
Catalog No.	A16099
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables RNA binding activity. Predicted to be involved in transmembrane receptor protein tyrosine kinase signaling pathway. Predicted to act upstream of or within rRNA transcription. Located in cytosol; mitochondrion; and nuclear lumen.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human CD3EAP (NP_036231.1).
Sequence	MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPLQPIPASPPPQIPPGLRPRFCAFGGNPPVTGPRSALAPNLL
Gene ID
Swiss Prot
Synonyms	ASE1; CAST; ASE-1; PAF49; RPA34; CD3EAP
Calculated MW	55kDa
Observed MW	70kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Mouse testis
Cellular location	Chromosome, Nucleus, nucleolus
Customer validation	WB(Homo sapiens) Other(Homo sapiens)