제품 > 항체 > 단일클론항체(mAb)

CD3E+CD3G Rabbit mAb (A20213)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using CD3E+CD3G Rabbit mAb (A20213) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Flow CytoMetry - CD3E+CD3G Rabbit mAb (A20213)

Flow cytometric analysis of CD3E+CD3G Rabbit mAb (A20213) (1μg/mL) in Jurkats cells (orange) compare to rabbit IgG Isotype control (blue) and non-staining control (Red).

Human peripheral blood lymphocytes stained with CD3E+CD3G Rabbit mAb (A20213) (1μg/mL) (orange). Secondary antibody only staining (Blue) and unstained sample (red) were used as a control.

Overview

Product name	CD3E+CD3G Rabbit mAb
Catalog No.	A20213
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5083-01

Background

The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-207(CD3E)& 1-182(CD3G) of human CD3 epsilon&CD3 gamma Heterodimer.
Sequence	MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI(CD3E)&MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN(CD3G)
Gene ID
Swiss Prot
Synonyms	CD3E; IMD18; T3E; TCRE; CD3e molecule; CD3G; CD3-GAMMA; IMD17; T3G; CD3E+CD3G
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Jurkat, MOLT-4
Cellular location	Cell membrane, Single-pass type I membrane protein, Membrane, Single-pass type I membrane protein
Customer validation	IF(Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD3E+CD3G Rabbit mAb images

Western blot - CD3E+CD3G Rabbit mAb (A20213)

Flow CytoMetry - CD3E+CD3G Rabbit mAb (A20213)

Flow cytometric analysis of CD3E+CD3G Rabbit mAb (A20213) (1μg/mL) in Jurkats cells (orange) compare to rabbit IgG Isotype control (blue) and non-staining control (Red).

Flow CytoMetry - CD3E+CD3G Rabbit mAb (A20213)

Human peripheral blood lymphocytes stained with CD3E+CD3G Rabbit mAb (A20213) (1μg/mL) (orange). Secondary antibody only staining (Blue) and unstained sample (red) were used as a control.

* For research use only. Not for therapeutic or diagnostic purposes.