제품 > 항체 > 단일클론항체(mAb)

CD3G Rabbit mAb (A25012)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD3G Rabbit mAb (A25012) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):HEL
Exposure time: 20s.

ABclonal:Immunohistochemistry - CD3G Rabbit mAb (A25012)

Immunohistochemistry analysis of CD3G in paraffin-embedded human colon tissue using CD3G Rabbit mAb (A25012) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of CD3G in paraffin-embedded human tonsil tissue using CD3G Rabbit mAb (A25012) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD3G Rabbit mAb (A25012)

Confocal imaging of Jurkat cells using CD3G Rabbit mAb (A25012, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of MOLT-4 cells using CD3G Rabbit mAb (A25012, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Overview

Product name	CD3G Rabbit mAb
Catalog No.	A25012
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65124

Background

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of human CD3G (NP_000064.1).
Sequence	QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS
Gene ID
Swiss Prot
Synonyms	T3G; IMD17; CD3GAMMA; CD3-GAMMA; CD3G
Calculated MW	20kDa
Observed MW	18-28kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:4000 IHC-P 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	MOLT-4, Jurkat
Cellular location	Cell membrane , Single-pass type I membrane protein
Customer validation	WB(Homo sapiens, Mus musculus) Co-IP(Homo sapiens, Mus musculus) RT-PCR(Homo sapiens, Mus musculus) ChIP(Homo sapiens) Co-IP(Homo sapiens) FC(Homo sapiens) IF(Homo sapiens) RT-qPCR(Homo sapiens)