제품 > 항체 > 단일클론항체(mAb)

CD3G Rabbit mAb (A4085)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CD3G Rabbit mAb (A4085) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

ABclonal:Immunofluorescence - CD3G Rabbit mAb (A4085)

Immunofluorescence analysis of Jurkat cells using CD3G Rabbit mAb (A4085) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Flow CytoMetry - CD3G Rabbit mAb (A4085)

Flow cytometry: 1X10^6 Raji cells (negative control, left) and Jurkat cells (right) were intracellularly-stained with CD3G Rabbit mAb (A4085, 2.5 μg/mL orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2.5 μg/mL, blue line). Non-fluorescently stained cells were used as blank control (red line) .

Overview

Product name	CD3G Rabbit mAb
Catalog No.	A4085
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2105

Background

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 83-182 of human CD3G (P09693).
Sequence	GMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN
Gene ID
Swiss Prot
Synonyms	T3G; IMD17; CD3GAMMA; CD3-GAMMA
Calculated MW	20kDa
Observed MW	24kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 FC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples	Rat lung, Rat spleen
Cellular location	Cell membrane
Customer validation	IF(Homo sapiens) FC(Mus musculus) WB(Homo sapiens) IP(Homo sapiens)