제품 > 항체 > 단일클론항체(mAb)

CD3H Rabbit mAb (A11157)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Jurkat cells, using CD3H Rabbit mAb (A11157) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunohistochemistry - CD3H Rabbit mAb (A11157)

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD3H Rabbit mAb (A11157) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CD3H Rabbit mAb (A11157) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Flow CytoMetry - CD3H Rabbit mAb (A11157)

Flow cytometry:1X10^6 Raji cells (negative control, left) and Jurkat cells (right) were intracellularly-stained with CD3H Rabbit mAb(A11157, 10 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Overview

Product name	CD3H Rabbit mAb
Catalog No.	A11157
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0533

Background

The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963).
Sequence	QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Gene ID
Swiss Prot
Synonyms	T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3ZETA; CD3-ZETA
Calculated MW	19kDa
Observed MW	16kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:50 - 1:200 FC (intra) 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Jurkat
Cellular location	Membrane, Single-pass type I membrane protein.
Customer validation	WB(Homo sapiens) IP(Homo sapiens)