Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CD40 Rabbit pAb |
---|---|
Catalog No. | A0218 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence within amino acids 198-277 of human CD40 (NP_001241.1). |
---|---|
Sequence | IPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ |
Gene ID | |
Swiss Prot | |
Synonyms | p50; Bp50; CDW40; TNFRSF5; CD40 |
Calculated MW | 31kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Raji |
Cellular location | Cell membrane, Secreted, Single-pass type I membrane protein. |
Customer validation | WB(Mauremys sinensis , Homo sapiens, Oryctolagus cuniculus) IHC(Homo sapiens) IF(Homo sapiens) FC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0218? Please let us know so that we can cite the reference in this datasheet.