Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CD48 Rabbit mAb |
---|---|
Catalog No. | A4084 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53030 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48 (NP_001769.2). |
---|---|
Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
Gene ID | |
Swiss Prot | |
Synonyms | BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102 |
Calculated MW | 19kDa/27kDa |
Observed MW | 46kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Flow Cytometry |
Positive samples | Jurkat, Raji, RAW 264.7, Mouse thymus |
Cellular location | Cell membrane, Secreted |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.