제품 > 항체 > 단일클론항체(mAb)

CD55 Rabbit mAb (A11283)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD55 Rabbit mAb (A11283) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - CD55 Rabbit mAb (A11283)

Immunohistochemistry analysis of paraffin-embedded human placenta using CD55 Rabbit mAb (A11283) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Review

Overview

Product name	CD55 Rabbit mAb
Catalog No.	A11283
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0568

Background

This gene encodes a glycoprotein involved in the regulation of the complement cascade. Binding of the encoded protein to complement proteins accelerates their decay, thereby disrupting the cascade and preventing damage to host cells. Antigens present on this protein constitute the Cromer blood group system (CROM). Alternative splicing results in multiple transcript variants. The predominant transcript variant encodes a membrane-bound protein, but alternatively spliced transcripts may produce soluble proteins.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174).
Sequence	EGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLK
Gene ID
Swiss Prot
Synonyms	CR; TC; DAF; CROM; CHAPLE; CD55
Calculated MW	41kDa
Observed MW	78kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HepG2, A-549
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor, Secreted, Single-pass type I membrane protein
Customer validation	(Hela 、PC-3) WB(Homo sapiens)