제품 > 항체 > 단일클론항체(mAb)

CD70 Rabbit mAb (A20589)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CD70 Rabbit mAb (A20589) at dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Flow CytoMetry - CD70 Rabbit mAb (A20589)

Flow cytometry:1×10^6 Raji cells were stained with CD70 Rabbit mAb (A20589, 1 ug/ml Blue line) . Non-fluorescently stained Raji cells were used as blank control (red line).

Overview

Product name	CD70 Rabbit mAb
Catalog No.	A20589
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC5081-01

Background

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 39-193 of human CD70 (P32970).
Sequence	QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Gene ID
Swiss Prot
Synonyms	CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A; CD70
Calculated MW	21kDa
Observed MW	21-27kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 FC 1:100 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Raji
Cellular location	Extracellular exosome, Plasma membrane.

Research Area

CD70 Rabbit mAb images

Western blot - CD70 Rabbit mAb (A20589)

Flow CytoMetry - CD70 Rabbit mAb (A20589)

Flow cytometry:1×10^6 Raji cells were stained with CD70 Rabbit mAb (A20589, 1 ug/ml Blue line) . Non-fluorescently stained Raji cells were used as blank control (red line).

* For research use only. Not for therapeutic or diagnostic purposes.