Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using CD80 Rabbit mAb (A23688) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Western blot analysis of various lysates, using CD80 Rabbit mAb (A23688) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Flow cytometry:1X10^6 Neuro-2a cells(negative control, left) and C2C12 cells(right) were surface-stained with CD80 Rabbit mAb(A23688, 2μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 2μg/mL, blue line).Non-fluorescently stained cells was used as blank control (red line).
| Product name | CD80 Rabbit mAb |
|---|---|
| Catalog No. | A23688 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC61485 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 38-245 of mouse CD80(NP_033985.3) |
|---|---|
| Sequence | VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | B71; Ly53; TSA1; Cd28l; Ly-53; MIC17; CD80 |
| Calculated MW | 34kDa |
| Observed MW | 50-75kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Flow Cytometry |
| Positive samples | Raji, RAW 264.7, C2C12 |
| Cellular location | Membrane, Single-pass type I membrane protein Philippe Le Mercier. |
| Customer validation | WB(Mus musculus, Homo sapiens) IF(Mus musculus) FC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A23688? Please let us know so that we can cite the reference in this datasheet.
