Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CDC34 Rabbit pAb |
---|---|
Catalog No. | A5457 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-236 of human CDC34 (NP_004350.1). |
---|---|
Sequence | KWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES |
Gene ID | |
Swiss Prot | |
Synonyms | UBC3; UBCH3; UBE2R1; E2-CDC34; CDC34 |
Calculated MW | 27kDa |
Observed MW | 32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HeLa, Jurkat, C6, SH-SY5Y, Mouse testis |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | IHC(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5457? Please let us know so that we can cite the reference in this datasheet.