제품 > 항체 > 단일클론항체(mAb)

CDC42 Rabbit mAb (A19028)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CDC42 Rabbit mAb (A19028) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	CDC42 Rabbit mAb
Catalog No.	A19028
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0484

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 60-191 of human CDC42 (P60953).
Sequence	GQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
Gene ID
Swiss Prot
Synonyms	TKS; G25K; CDC42Hs; CDC42
Calculated MW	21kDa
Observed MW	21kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HT-29, PC-3, NIH/3T3, C6, Mouse liver, Mouse brain, Rat spleen
Cellular location	Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, centrosome, cytoskeleton, microtubule organizing center, spindle.
Customer validation	( MCF-7 、 Jurkat、MLOT-4 、T-47D 、 HeLa, RPMI-8226,HL-60,MCF-7,PC-3,Jurkat,Molt-4,T-47D,Hela,293T) WB(Rattus norvegicus, Homo sapiens)