Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CDC42 Rabbit pAb |
---|---|
Catalog No. | A1188 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 118-191 of human CDC42 (NP_001782.1). |
---|---|
Sequence | DLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL |
Gene ID | |
Swiss Prot | |
Synonyms | TKS; G25K; CDC42Hs; CDC42 |
Calculated MW | 21kDa |
Observed MW | 21kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | PC-3, NIH/3T3, Jurkat, C6, Mouse brain, Rat brain |
Cellular location | Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, Midbody, centrosome, cytoskeleton, microtubule organizing center, spindle. |
Customer validation | WB(Rattus norvegicus, Mus musculus, Homo sapiens) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1188? Please let us know so that we can cite the reference in this datasheet.