Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | SYN1 Rabbit pAb |
---|---|
Catalog No. | A17362 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SYN1. (NP_008881.2). |
---|---|
Sequence | MNYLRRRLSDSNFMANLPNGYMTDLQRPQPPPPPPGAHSPGATPGPGTATAERSSGVAPAASPAAPSPGSSGGGGFFSSLSNAVKQTTAAAAATFSEQVG |
Gene ID | |
Swiss Prot | |
Synonyms | SYNI; EPILX; MRX50; SYN1a; SYN1b; EPILX1; SYN1 |
Calculated MW | 74kDa |
Observed MW | 74kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | mouse heart, rat brain |
Cellular location | Cell junction, Golgi apparatus, synapse |
Customer validation | WB(Mus musculus, Rattus norvegicus) IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17362? Please let us know so that we can cite the reference in this datasheet.