제품 > 항체 > 다중클론항체(pAb)

SOAT1 Rabbit pAb (A6311)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using SOAT1 antibody (A6311) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - SOAT1 Rabbit pAb (A6311)

Immunofluorescence analysis of U2OS cells using SOAT1 Rabbit pAb (A6311) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using SOAT1 Rabbit pAb (A6311) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of C6 cells using SOAT1 Rabbit pAb (A6311) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	SOAT1 Rabbit pAb
Catalog No.	A6311
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the acyltransferase family. It is located in the endoplasmic reticulum, and catalyzes the formation of fatty acid-cholesterol esters. This gene has been implicated in the formation of beta-amyloid and atherosclerotic plaques by controlling the equilibrium between free cholesterol and cytoplasmic cholesteryl esters. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SOAT1 (NP_003092.4).
Sequence	MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLD
Gene ID
Swiss Prot
Synonyms	ACAT; SOAT; STAT; ACACT; ACAT1; ACAT-1
Calculated MW	65kDa
Observed MW	55kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	H460, HeLa, SW480, Mouse stomach, Mouse liver, Rat liver, Rat stomach
Cellular location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Customer validation	WB(Mus musculus) IHC(Homo sapiens) IF(Mus musculus)