Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | mTOR Rabbit pAb |
---|---|
Catalog No. | A24743 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1). |
---|---|
Sequence | CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI |
Gene ID | |
Swiss Prot | |
Synonyms | SKS; FRAP; FRAP1; FRAP2; RAFT1; RAPT1; mTOR |
Calculated MW | 289kDa |
Observed MW | 289kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Hep G2 |
Cellular location | Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Golgi apparatus membrane, Lysosome, Mitochondrion outer membrane, Nucleus, PML body, Peripheral membrane protein |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.