Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using CDK1 Rabbit mAb (A11420) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of lysates from Mouse spleen, using CDK1 Rabbit mAb (A11420) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Immunofluorescence analysis of HeLa cells using CDK1 Rabbit mAb (A11420) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using CDK1 Rabbit mAb (A11420) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using CDK1 Rabbit mAb (A11420) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation of CDK1 from 300 µg extracts of 293T cells was performed using 3 µg of CDK1 Rabbit mAb (A11420). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CDK1 Rabbit mAb (A11420) at a dilution of 1:1000.
| Product name | CDK1 Rabbit mAb |
|---|---|
| Catalog No. | A11420 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC50607 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1). |
|---|---|
| Sequence | ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CDC2; CDC28A; P34CDC2; CDK1 |
| Calculated MW | 34kDa |
| Observed MW | 34kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, MCF7, Jurkat, Mouse spleen |
| Cellular location | Cytoplasm, Mitochondrion, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle. |
| Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus) IHC(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11420? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1716194440)
