Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CDK1 Rabbit mAb |
---|---|
Catalog No. | A11420 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50607 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1). |
---|---|
Sequence | ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Gene ID | |
Swiss Prot | |
Synonyms | CDC2; CDC28A; P34CDC2; CDK1 |
Calculated MW | 34kDa |
Observed MW | 34kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunoprecipitation |
Positive samples | HeLa, MCF7, Jurkat, Mouse spleen |
Cellular location | Cytoplasm, Mitochondrion, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Gallus gallus) IHC(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11420? Please let us know so that we can cite the reference in this datasheet.