Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | CDKN2A/p19ARF Rabbit mAb |
---|---|
Catalog No. | A24653 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC62845 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse p19ARF (NP_034007.1). |
---|---|
Sequence | MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA |
Gene ID | |
Swiss Prot | |
Synonyms | Arf; p16; MTS1; Pctr1; p19ARF; p16INK4a; p19 |
Calculated MW | 19KDa |
Observed MW | 21kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A20 |
Cellular location | Nucleus, nucleoplasm. |
Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24653? Please let us know so that we can cite the reference in this datasheet.