제품 > 항체 > 다중클론항체(pAb)

C/EBPB Rabbit pAb (A0711)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using C/EBPB Rabbit pAb (A0711) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - C/EBPB Rabbit pAb (A0711)

Immunohistochemistry analysis of paraffin-embedded Rat kidney using C/EBPB Rabbit pAb (A0711) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using C/EBPB Rabbit pAb (A0711) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	C/EBPB Rabbit pAb
Catalog No.	A0711
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 171-216 of human C/EBPB (NP_005185.2).
Sequence	AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
Gene ID
Swiss Prot
Synonyms	TCF5; IL6DBP; NF-IL6; C/EBP-beta; C/EBPB
Calculated MW	36kDa
Observed MW	48kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SK-MEL-28, HeLa, NIH/3T3
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Mus musculus,Rattus norvegicus, Homo sapiens) IHC(Mus musculus)