제품 > 항체 > 단일클론항체(mAb)

CECR5 Rabbit mAb (A20974)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using CECR5 Rabbit mAb (A20974) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - CECR5 Rabbit mAb (A20974)

Immunofluorescence analysis of HeLa cells using CECR5 Rabbit mAb (A20974) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CECR5 Rabbit mAb
Catalog No.	A20974
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2965

Background

Predicted to be involved in glycerophospholipid biosynthetic process. Predicted to be active in mitochondrion.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 324-423 of human CECR5 (Q9BXW7).
Sequence	LFHQYLQKATHDGAPELGAGGTRQQQPSASQSCISILVCTGVYNPRNPQSTEPVLGGGEPPFHGHRDLCFSPGLMEASHVVNDVNEAVQLVFRKEGWALE
Gene ID
Swiss Prot
Synonyms	CECR5
Calculated MW	46kDa
Observed MW	44kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Jurkat, K-562
Cellular location	mitochondrion.