Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | CELF2 Rabbit pAb |
---|---|
Catalog No. | A6016 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 422-521 of human CELF2 (NP_006552.3). |
---|---|
Sequence | QQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY |
Gene ID | |
Swiss Prot | |
Synonyms | ETR3; DEE97; ETR-3; NAPOR; CELF-2; CUGBP2; BRUNOL3; CUG-BP2 |
Calculated MW | 54kDa |
Observed MW | 60kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | MCF7, HeLa |
Cellular location | Cytoplasm, Nucleus |
* For research use only. Not for therapeutic or diagnostic purposes.