Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CELF5 Rabbit pAb |
---|---|
Catalog No. | A18482 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-45 of human CELF5 (NP_001166144.1). |
---|---|
Sequence | MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAI |
Gene ID | |
Swiss Prot | |
Synonyms | CELF-5; BRUNOL5; BRUNOL-5; CELF5 |
Calculated MW | 52kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | U-251MG, U-87MG, Mouse testis |
Cellular location | cytoplasm, nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.