Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CEMIP Rabbit pAb |
---|---|
Catalog No. | A8587 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-420 of human CEMIP (NP_001280227.1). |
---|---|
Sequence | FERSWGHRGVIVHVIDPKSGTVIHSDRFDTYRSKKESERLVQYLNAVPDGRILSVAVNDEGSRNLDDMARKAMTKLGSKHFLHLGFRHPWSFLTVKGNPSSSVEDHIEYHGHRGSAAARVFKLFQTEHGEYFNVSLSSEWVQDVEWTEWFDHDKVSQTKGGEKISDLWKAHPGKICNRPIDIQATTMDGVNLSTEVVYKKGQDYRFACYDRGRACRSYRVRFLCGKPVRPKLTVTIDTNVN |
Gene ID | |
Swiss Prot | |
Synonyms | CCSP1; HYBID; TMEM2L; KIAA1199; CEMIP |
Calculated MW | 153kDa |
Observed MW | 180kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-431, U-87MG, Mouse brain |
Cellular location | Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus, Secreted, clathrin-coated pit |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus) IHC(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A8587? Please let us know so that we can cite the reference in this datasheet.