제품 > 항체 > 다중클론항체(pAb)

CEP131 Rabbit pAb (A17648)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from HeLa cells, using CEP131 Rabbit pAb (A17648) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	CEP131 Rabbit pAb
Catalog No.	A17648
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables protein homodimerization activity. Involved in several processes, including intraciliary transport involved in cilium assembly; protein localization to centrosome; and regulation of centrosome duplication. Located in several cellular components, including ciliary transition zone; intercellular bridge; and microtubule organizing center. Colocalizes with centrosome.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1000-1083 of human CEP131 (NP_001306157.1).
Sequence	IRQEFEDRLAASEEETRQAKAELATLQARQQLELEEVHRRVKTALARKEEAVSSLRTQHEAAVKRADHLEELLEQHRRPTPSTK
Gene ID
Swiss Prot
Synonyms	AZ1; ZA1; AZI1; CEP131
Calculated MW	122kDa
Observed MW	145kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	centriole, centrosome, ciliary basal body, ciliary transition zone, cytosol, intercellular bridge, microtubule cytoskeleton