제품 > 항체 > 다중클론항체(pAb)

CETN2 Rabbit pAb (A21821)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of Rat spleen, using CETN2 Rabbit pAb (A21821) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - CETN2 Rabbit pAb (A21821)

Immunofluorescence analysis of A549 cells using CETN2 antibody (A21821).

Immunofluorescence analysis of GFP-RNF168 transgenic U2OS cells using CETN2 antibody (A21821). Green：GFP-RNF168 fusion protein expression for DNA damage marker.Blue: DAPI for nuclear staining. RNF168 (GFP) can be used to mark cells damaged by UV-A laser for they always gather around DNA damage region.

Overview

Product name	CETN2 Rabbit pAb
Catalog No.	A21821
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Caltractin belongs to a family of calcium-binding proteins and is a structural component of the centrosome. The high level of conservation from algae to humans and its association with the centrosome suggested that caltractin plays a fundamental role in the structure and function of the microtubule-organizing center, possibly required for the proper duplication and segregation of the centrosome.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human CETN2 (NP_004335.1).
Sequence	MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Gene ID
Swiss Prot
Synonyms	CALT; CEN2
Calculated MW	20kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Rat spleen
Cellular location	Cytoplasm, Nucleus, centriole, centrosome, cytoskeleton, microtubule organizing center