제품 > 항체 > 단일클론항체(mAb)

CFAP20/GTL3 Rabbit mAb (A24115)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CFAP20/GTL3 Rabbit mAb (A24115) at 1:6000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - CFAP20/GTL3 Rabbit mAb (A24115)

Immunohistochemistry analysis of paraffin-embedded Rat bronchus tissue using CFAP20/GTL3 Rabbit mAb (A24115) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using CFAP20/GTL3 Rabbit mAb (A24115) at a dilution of 1:300 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	CFAP20/GTL3 Rabbit mAb
Catalog No.	A24115
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58773

Background

Enables RNA binding activity. Involved in several processes, including positive regulation of feeding behavior; protein polyglutamylation; and regulation of cell motility. Located in centriole; ciliary basal body; and nucleoplasm.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 94-193 of human CFAP20/GTL3 (NP_037374.1).
Sequence	LDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
Gene ID
Swiss Prot
Synonyms	GTL3; BUG22; EVORF; fSAP23; C16orf80; CFAP20/GTL3
Calculated MW	23kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:7000 IHC-P 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Hep G2, Mouse testis
Cellular location	Cell projection, Cytoplasm, Nucleus, centriole, centrosome, cilium, cilium basal body, cytoskeleton, microtubule organizing center.