제품 > 항체 > 다중클론항체(pAb)

CFAP61 Rabbit pAb (A18194)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse eye, using CFAP61 Rabbit pAb (A18194) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - CFAP61 Rabbit pAb (A18194)

Immunohistochemistry analysis of paraffin-embedded Human colon using CFAP61 Rabbit pAb (A18194) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - CFAP61 Rabbit pAb (A18194)

Immunofluorescence analysis of paraffin-embedded mouse testis using CFAP61 Rabbit pAb (A18194) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CFAP61 Rabbit pAb
Catalog No.	A18194
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Predicted to be involved in cilium movement and cilium organization. Predicted to be located in axoneme and motile cilium. Predicted to colocalize with radial spoke stalk.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CFAP61 (NP_056400.3).
Sequence	MSVLTSPRGKVEVVHCRRTESQDVYCIKSLIRKFTCKLFGKLNIIYLLEKANLAVTLCNDKEEIMAQATFLDYPNWNVAKQDDWVSVFRELDSDIPCTPL
Gene ID
Swiss Prot
Synonyms	CaM-IP3; C20orf26; dJ1002M8.3; dJ1178H5.4; CFAP61
Calculated MW	141kDa
Observed MW	141kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse eye
Cellular location	axoneme
Customer validation	IHC(Mus musculus) WB(Mus musculus)