제품 > 항체 > 다중클론항체(pAb)

CHCHD4 Rabbit pAb (A25029)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using CHCHD4 Rabbit pAb (A25029) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.

ABclonal:Immunohistochemistry - CHCHD4 Rabbit pAb (A25029)

Immunohistochemistry analysis of CHCHD4 in paraffin-embedded rat kidney tissue using CHCHD4 Rabbit pAb (A25029) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of CHCHD4 in paraffin-embedded human liver cancer tissue using CHCHD4 Rabbit pAb (A25029) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	CHCHD4 Rabbit pAb
Catalog No.	A25029
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-105of human CHCHD4 (NP_001091972.1).
Sequence	MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLY
Gene ID
Swiss Prot
Synonyms	MIA40; TIMM40; CHCHD4
Calculated MW	16kDa
Observed MW	22kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	A549, 293T
Cellular location	Mitochondrion intermembrane space