제품 > 항체 > 단일클론항체(mAb)

CHX10 Rabbit mAb (A19828)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various lysates, using CHX10 Rabbit mAb (A19828) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Overview

Product name	CHX10 Rabbit mAb
Catalog No.	A19828
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2354

Background

This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 262-361 of human CHX10 (P58304).
Sequence	AAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA
Gene ID
Swiss Prot
Synonyms	RET1; CHX10; HOX10; MCOP2; MCOPCB3
Calculated MW	39kDa
Observed MW	43kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse spinal cord, Mouse brain, Rat spinal cord, Rat brain
Cellular location	Nucleus