제품 > 항체 > 다중클론항체(pAb)

CKMT1B Rabbit pAb (A3046)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CKMT1B Rabbit pAb (A3046) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - CKMT1B Rabbit pAb (A3046)

Immunofluorescence analysis of NIH-3T3 cells using CKMT1B Rabbit pAb (A3046) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using CKMT1B Rabbit pAb (A3046) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - CKMT1B Rabbit pAb (A3046)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg CKMT1B antibody (A3046). Western blot was performed from the immunoprecipitate using CKMT1B antibody (A3046) at a dilution of 1:1000.

Overview

Product name	CKMT1B Rabbit pAb
Catalog No.	A3046
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human CKMT1B (NP_066270.1).
Sequence	MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWT
Gene ID
Swiss Prot
Synonyms	CKMT; CKMT1; UMTCK; CKMT1B
Calculated MW	47kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	Mouse brain, Mouse kidney, Rat brain
Cellular location	Intermembrane side, Mitochondrion inner membrane, Peripheral membrane protein