Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | CLDN3 Rabbit pAb |
---|---|
Catalog No. | A11650 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 141-220 of human CLDN3 (NP_001297.1). |
---|---|
Sequence | TIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV |
Gene ID | |
Swiss Prot | |
Synonyms | RVP1; HRVP1; C7orf1; CPE-R2; CPETR2; CLDN3 |
Calculated MW | 23kDa |
Observed MW | 27kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Mouse lung, Rat liver |
Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, tight junction |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Homo sapiens) IF(Homo sapiens) Other(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11650? Please let us know so that we can cite the reference in this datasheet.