Reviews (2)Publications (31) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using CLDN5 Rabbit pAb (A10207) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH/3T3 cells using CLDN5 Rabbit pAb (A10207) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using CLDN5 Rabbit pAb (A10207) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | CLDN5 Rabbit pAb |
|---|---|
| Catalog No. | A10207 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 119-218 of human CLDN5 (NP_001349995.1). |
|---|---|
| Sequence | LTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | AWAL; BEC1; TMVCF; TMDVCF; CPETRL1; CLDN5 |
| Calculated MW | 23kDa |
| Observed MW | 22kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Mouse lung, Rat lung |
| Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, tight junction |
| Customer validation | (Mouse embryonal fibroblast cell) WB(Rattus norvegicus, Mus musculus, Homo sapiens, Mus musculus, Other) IF(Mus musculus, Rattus norvegicus, Homo sapiens) IHC(Homo sapiens, Mus musculus, Rattus norvegicus) ELISA(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A10207? Please let us know so that we can cite the reference in this datasheet.
