제품 > 항체 > 다중클론항체(pAb)

CLDN7 Rabbit pAb (A2035)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse large intestine using CLDN7 Rabbit pAb(A2035) at 1:2000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:25s.

ABclonal:Immunofluorescence - CLDN7 Rabbit pAb (A2035)

Immunofluorescence analysis of human colon using CLDN7 Rabbit pAb (A2035) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Immunofluorescence analysis of rat large intestine using CLDN7 Rabbit pAb (A2035) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Review

Overview

Product name	CLDN7 Rabbit pAb
Catalog No.	A2035
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Differential expression of this gene has been observed in different types of malignancies, including breast cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors, prostate cancer, lung cancer, head and neck cancers, thyroid carcinomas, etc.. Alternatively spliced transcript variants encoding different isoforms have been found.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-211 of human CLDN7 (NP_001298.3).
Sequence	QWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
Gene ID
Swiss Prot
Synonyms	CLDN-7; CEPTRL2; CPETRL2; Hs.84359; claudin-1; CLDN7
Calculated MW	22kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse large intestine
Cellular location	Cell junction, Cell membrane, Lateral cell membrane, Multi-pass membrane protein, tight junction
Customer validation	(Mouse colon) IHC(Mus musculus) WB(Canis lupus familiaris, Homo sapiens, Mus musculus) IF(Mus musculus)