Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CLEC4A Rabbit pAb |
---|---|
Catalog No. | A2713 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4A (Q9UMR7). |
---|---|
Sequence | MTSEITYAEVRFKNEFKSSGINTASSAASKERTAPHKSNTGFPKLLCASLLIFFLLLAISFFIAFVIFFQKYSQLLEKKTTKELVHTTLECVKKNMPVEE |
Gene ID | |
Swiss Prot | |
Synonyms | DCIR; LLIR; CD367; DDB27; hDCIR; CLECSF6; HDCGC13P; CLEC4A |
Calculated MW | 28kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-549, HeLa, HT-29, Mouse spleen, Mouse lung |
Cellular location | Membrane, Single-pass type II membrane protein |
* For research use only. Not for therapeutic or diagnostic purposes.