Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CLEC7A Rabbit pAb |
---|---|
Catalog No. | A9883 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 140-240 of human CLEC7A (NP_922938.1). |
---|---|
Sequence | SWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSI |
Gene ID | |
Swiss Prot | |
Synonyms | BGR; CD369; CANDF4; SCARE2; DECTIN1; CLECSF12; CLEC7A |
Calculated MW | 28kDa |
Observed MW | 31kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | H-460, SGC-7901, HL-60, Mouse spleen, Mouse thymus, Mouse liver, Mouse lung, Rat spleen |
Cellular location | Cell membrane, Cytoplasm, Single-pass type II membrane protein |
Customer validation | WB(Mus musculus, Sus scrofa) FC(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9883? Please let us know so that we can cite the reference in this datasheet.