제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD369/Dectin-1 mAb (A24271)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Human CD369/Dectin-1 mAb(A24271, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line).Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD369/Dectin-1 mAb(A24271, 5 μl/Test, right).

Overview

Product name	ABflo® 488 Rabbit anti-Human CD369/Dectin-1 mAb
Catalog No.	A24271
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC61646-ABflo488

Background

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1, 3-linked and beta-1, 6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human CD369/Dectin-1 (NP_922938.1).
Sequence	TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM
Gene ID
Swiss Prot
Synonyms	CLEC7A; BGR; CANDF4; CD369; CLECSF12; DECTIN1; SCARE2; C-type lectin domain containing 7A
Calculated MW	5kDa/8kDa/13-27kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, cytoplasm, single-pass type II membrane protein