Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse
Product name | CLSTN3 Rabbit pAb |
---|---|
Catalog No. | A15765 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 730-850 of human CLSTN3 (NP_055533.2). |
---|---|
Sequence | SLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAATL |
Gene ID | |
Swiss Prot | |
Synonyms | CSTN3; CDHR14; alcbeta; CLSTN3 |
Calculated MW | 106kDa |
Observed MW | 105kDa |
Reactivity | Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse brain |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Golgi apparatus membrane, Single-pass type I membrane protein |
Customer validation | IF(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15765? Please let us know so that we can cite the reference in this datasheet.