제품 > 항체 > 다중클론항체(pAb)

CNPY3 Rabbit pAb (A7176)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CNPY3 Rabbit pAb (A7176) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.

ABclonal:Immunohistochemistry - CNPY3 Rabbit pAb (A7176)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using CNPY3 Rabbit pAb (A7176) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - CNPY3 Rabbit pAb (A7176)

Immunoprecipitation analysis of 300ug extracts of THP-1 cells using 3ug CNPY3 Rabbit pAb (A7176 1:40). Western blot was performed from the immunoprecipitate using CNPY3 Rabbit pAb (A7176) at a dilition of 1:500.

Overview

Product name	CNPY3 Rabbit pAb
Catalog No.	A7176
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that binds members of the toll-like receptor protein family and functions as a chaperone to aid in folding and export of these proteins. Alternative splicing results in multiple transcript variants. Naturally occuring readthrough transcription occurs between this locus and the downstream GNMT (glycine N-methyltransferase) gene and is represented with GeneID:107080644.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-278 of human CNPY3 (NP_006577.2).
Sequence	GPSQAGAEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTETICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSSRAKAAGGRSSSSKQRKELGGLEGDPSPEEDEGIQKASPLTHSPPDEL
Gene ID
Swiss Prot
Synonyms	CAG4A; DEE60; ERDA5; TNRC5; EIEE60; PRAT4A; CNPY3
Calculated MW	31kDa
Observed MW	38kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HepG2, MCF7, THP-1, HL-60, U-937
Cellular location	Endoplasmic reticulum
Customer validation	IHC(Homo sapiens)