제품 > 항체 > 단일클론항체(mAb)

COL11A1 Rabbit mAb (A24604)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using COL11A1 Rabbit mAb (A24604) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - COL11A1 Rabbit mAb (A24604)

Confocal imaging of A-204 cells using COL11A1 Rabbit mAb (A24604, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	COL11A1 Rabbit mAb
Catalog No.	A24604
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63678

Background

This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3).
Sequence	NIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEE
Gene ID
Swiss Prot
Synonyms	STL2; COLL6; CO11A1; DFNA37; COL11A1
Calculated MW	167kDa/176kDa/181kDa/182kDa
Observed MW	280kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:12000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: 59% PBS with 0.01% Sodium azide, 0.05% BSA, 40% Glycerol, PH 7.2
Key application	Western blotting Immunofluorescence
Positive samples	A-204, U-2 OS(Low expression control)
Cellular location	Secreted, extracellular matrix, extracellular space.