Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | COL4A1 Rabbit pAb |
---|---|
Catalog No. | A10710 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1445-1669 of human COL4A1 (NP_001836.2). |
---|---|
Sequence | GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT |
Gene ID | |
Swiss Prot | |
Synonyms | BSVD; BSVD1; RATOR; PADMAL; COL4A1s; COL4A1 |
Calculated MW | 161kDa |
Observed MW | 160kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | U-87 MG |
Cellular location | Secreted, basement membrane, extracellular matrix, extracellular space. |
Customer validation | WB(Gallus gallus, Mus musculus) IHC(Sus scrofa, Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A10710? Please let us know so that we can cite the reference in this datasheet.