제품 > 항체 > 다중클론항체(pAb)

COR28 Rabbit pAb (A21278)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Arabidopsis thaliana

Western blot analysis of extracts of various tissues from Arabidopsis thaliana, using COR28 Rabbit pAb (A21278) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	COR28 Rabbit pAb
Catalog No.	A21278
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Light and temperature are two key environmental signals that profoundly affect plant growth and development, COR28 and COR27 are negative regulators of freezing tolerance but positive regulators of flowering. They are involved in central circadian clock regulation and in flowering promotion, by binding to the chromatin of clock-associated evening genes TOC1, PRR5, ELF4 and cold-responsive genes in order to repress their transcription. And also are direct targets of CCA1, which represses their transcription via chromatin binding.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 50-170 of arabidopsis thaliana COR28 (NP_567946.1).
Sequence	SKLDECTAWTNEKHNSYLDYLESSFVRQLYSLLGGGTQRLSRTRDVQSNSHKSADQFTVLQNGCWQKVNFGKKQSCLETSSEFRFHRNSLRNKPENSNGNYTMGTTVQGDVLCHDETKHSE
Gene ID
Swiss Prot
Synonyms	F17I5.170; F17I5_170; COR28
Calculated MW	25kDa
Observed MW	30kDa

Applications

Reactivity	Arabidopsis thaliana
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Seedling, Inflorescences, Before inflorescence, Rosette leaf
Cellular location	nucleus