제품 > 항체 > 단일클론항체(mAb)

COUP-TFII/NR2F2 Rabbit mAb (A24647)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using COUP-TFII/NR2F2 Rabbit mAb (A24647) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):MOLT-4
Exposure time: 45s.

ABclonal:Immunohistochemistry - COUP-TFII/NR2F2 Rabbit mAb (A24647)

Immunohistochemistry analysis of COUP-TFII/NR2F2 in paraffin-embedded rat kidney using COUP-TFII/NR2F2 Rabbit mAb (A24647) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of COUP-TFII/NR2F2 in paraffin-embedded rat spleen using COUP-TFII/NR2F2 Rabbit mAb (A24647) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - COUP-TFII/NR2F2 Rabbit mAb (A24647)

Immunoprecipitation analysis of 300ug extracts of MCF7 cells using 3ug COUP-TFII/NR2F2 antibody (A24647 1:100). Western blot was performed from the immunoprecipitate using COUP-TFII/NR2F2 antibody (A24647) at a dilition of 1:1000.

Overview

Product name	COUP-TFII/NR2F2 Rabbit mAb
Catalog No.	A24647
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63406

Background

This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 5-100 of human COUP-TFII/NR2F2 (NP_066285.1).
Sequence	VSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCK
Gene ID
Swiss Prot
Synonyms	ARP1; ARP-1; CHTD4; NF-E3; SRXX5; SVP40; COUPTF2; COUPTFB; TFCOUP2; COUPTFII; COUP-TFII/NR2F2
Calculated MW	46kDa
Observed MW	47kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	MCF7, 293T, NIH/3T3, C6, PC-12
Cellular location	Nucleus