제품 > 항체 > 단일클론항체(mAb)

COX7A1 Rabbit mAb (A21240)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse heart, using COX7A1 Rabbit mAb (A21240) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of various lysates, using COX7A1 Rabbit mAb (A21240) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

ABclonal:Immunohistochemistry - COX7A1 Rabbit mAb (A21240)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using COX7A1 Rabbit mAb (A21240) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human skeletal muscle using COX7A1 Rabbit mAb (A21240) at dilution of 1:5000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - COX7A1 Rabbit mAb (A21240)

Confocal imaging of Human heart using COX7A1 Rabbit mAb(A21240, 1:100)(Red).DAPI was used for nuclear staining(blue).Objective:40x.

Overview

Product name	COX7A1 Rabbit mAb
Catalog No.	A21240
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53426

Background

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-79 of human COX7A1 (NP_001855.1).
Sequence	MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Gene ID
Swiss Prot
Synonyms	COX7A; COX7AH; COX7AM; COX7A1
Calculated MW	9kDa
Observed MW	9kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:20000 IHC-P 1:2000 - 1:6000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	A549, 293T, Mouse heart, Rat heart, Rat skeletal muscle
Cellular location	Mitochondrion inner membrane