제품 > 항체 > 다중클론항체(pAb)

CPEB3 Rabbit pAb (A15402)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Rat kidney using CPEB3 Rabbit pAb (A15402) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - CPEB3 Rabbit pAb (A15402)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using CPEB3 Rabbit pAb (A15402) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using CPEB3 Rabbit pAb (A15402) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CPEB3 Rabbit pAb (A15402)

Immunofluorescence analysis of Neuro-2a cells using CPEB3 Rabbit pAb (A15402) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	CPEB3 Rabbit pAb
Catalog No.	A15402
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables mRNA 3'-UTR binding activity and translation factor activity, RNA binding. Involved in cellular response to amino acid stimulus; negative regulation of transcription by RNA polymerase II; and positive regulation of mRNA catabolic process. Located in several cellular components, including cytosol; midbody; and nucleoplasm. Part of CCR4-NOT complex.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 150-400 of human CPEB3 (NP_055727.3).
Sequence	TFSPQIGLAQTQHHQQPPPPAPAPQPAQPAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNVIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGT
Gene ID
Swiss Prot
Synonyms	CPEB3
Calculated MW	76kDa
Observed MW	75kDa/

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse heart, Mouse kidney, Rat heart, Rat kidney
Cellular location	apical dendrite, cytoplasm, cytosol, dendrite, neuron projection, nucleoplasm, nucleus, plasma membrane, postsynaptic density, synapse.
Customer validation	WB(Homo sapiens) IHC(Homo sapiens)