제품 > 항체 > 다중클론항체(pAb)

CRAT Rabbit pAb (A6365)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CRAT antibody (A6365) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - CRAT Rabbit pAb (A6365)

Immunofluorescence analysis of RD cells using CRAT Rabbit pAb (A6365) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	CRAT Rabbit pAb
Catalog No.	A6365
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes carnitine O-acetyltransferase, a member of the carnitine acyltransferase family and a key metabolic pathway enzyme which plays an important role in energy homeostasis and fat metabolism. This enzyme catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acyl-CoA/CoA. It is found in both the mitochondria and the peroxisome. Alternative splicing results in transcript variants encoding different isoforms that may localize to different subcellular compartments.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 380-626 of human CRAT (NP_000746.3).
Sequence	KLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKDFPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVKAMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL
Gene ID
Swiss Prot
Synonyms	CAT; CAT1; NBIA8
Calculated MW	71kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HepG2, BxPC-3, Mouse testis, Mouse skeletal muscle, Mouse heart, Rat testis
Cellular location	Endoplasmic reticulum, Matrix side, Mitochondrion, Mitochondrion inner membrane, Peripheral membrane protein, Peroxisome
Customer validation	WB(Homo sapiens)