제품 > 항체 > 다중클론항체(pAb)

CRHBP Rabbit pAb (A6568)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of Rat brain, using CRHBP Rabbit pAb (A6568) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Immunohistochemistry - CRHBP Rabbit pAb (A6568)

Immunohistochemistry analysis of CRHBP in paraffin-embedded mouse kidney tissue using CRHBP Rabbit pAb (A6568) at a dilution of 1:300 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of CRHBP in paraffin-embedded rat kidney tissue using CRHBP Rabbit pAb (A6568) at a dilution of 1:300 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CRHBP Rabbit pAb (A6568)

Immunofluorescence analysis of HeLa cells using CRHBP antibody (A6568). Blue: DAPI for nuclear staining.

Overview

Product name	CRHBP Rabbit pAb
Catalog No.	A6568
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-322 of human CRHBP (NP_001873.2).
Sequence	YLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Gene ID
Swiss Prot
Synonyms	CRFBP; CRF-BP
Calculated MW	36kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Rat brain
Cellular location	Secreted