제품 > 항체 > 단일클론항체(mAb)

CRMP5/DPYSL5 Rabbit mAb (A3503)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using CRMP5/DPYSL5 Rabbit mAb (A3503) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - CRMP5/DPYSL5 Rabbit mAb (A3503)

Immunohistochemistry analysis of paraffin-embedded rat spleen using CRMP5/DPYSL5 Rabbit mAb (A3503) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human appendix using CRMP5/DPYSL5 Rabbit mAb (A3503) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Overview

Product name	CRMP5/DPYSL5 Rabbit mAb
Catalog No.	A3503
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2020

Background

This gene encodes a member of the CRMP (collapsing response mediator protein) family thought to be involved in neural development. Antibodies to the encoded protein were found in some patients with neurologic symptoms who had paraneoplastic syndrome. A pseudogene of this gene is found on chromosome 11. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 465-564 of human CRMP5/DPYSL5 (Q9BPU6).
Sequence	RSFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW
Gene ID
Swiss Prot
Synonyms	CV2; CRAM; CRMP5; RTSC4; Ulip6; CRMP-5; CRMP5/DPYSL5
Calculated MW	61kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	SH-SY5Y, Mouse testis, Rat testis
Cellular location	Cytoplasm