Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Rat
Product name | CRYAB Rabbit mAb |
---|---|
Catalog No. | A9633 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1672 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 76-175 of human CRYAB (P02511). |
---|---|
Sequence | SVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK |
Gene ID | |
Swiss Prot | |
Synonyms | MFM2; CRYA2; CTPP2; HSPB5; CMD1II; CTRCT16; HEL-S-101; CRYAB |
Calculated MW | 20kDa |
Observed MW | 20kDa |
Reactivity | Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Rat lung, Rat kidney, Rat heart |
Cellular location | Cytoplasm, Nucleus, Secreted, Lysosome |
Customer validation | IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A9633? Please let us know so that we can cite the reference in this datasheet.