Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Chromatin immunoprecipitation was performed with 25 μg of cross-linked chromatin from 293T cells using 5 μg of CTCF Rabbit mAb (A19588). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of CTCF in the representative genomic region surrounding MYC gene.
Chromatin immunoprecipitation was performed with 25 μg of cross-linked chromatin from 293T cells using 5 μg of CTCF Rabbit mAb (A19588). DNA libraries were prepared using Scale ssDNA-seq Lib Prep Kit for Illumina V2 (RK20228). The ChIP sequencing results indicate the enrichment pattern of CTCF across chromosome 8 (upper panel) and the genomic region encompassing MYC, a representative gene enriched in CTCF (lower panel).
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 10⁵ K562 cells with 2 μg of CTCF Rabbit mAb (A19588), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The results denote the enrichment pattern of CTCF around MYC gene.
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 10⁵ K562 cells with 2ug μg of CTCF Rabbit mAb (A19588), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The CUT&Tag results denote the enrichment pattern of CTCF across chromosome 8 (upper panel) and the genomic region encompassing MYC, a representative gene enriched in CTCF (lower panel).
Western blot analysis of various lysates using CTCF Rabbit mAb (A19588) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Confocal imaging of U-2 OS cells using CTCF Rabbit mAb (A19588, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg CTCF antibody (A19588). Western blot was performed from the immunoprecipitate using CTCF antibody (A19588) at a dilution of 1:1000.
| Product name | CTCF Rabbit mAb |
|---|---|
| Catalog No. | A19588 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0067 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 628-727 of human CTCF (P49711). |
|---|---|
| Sequence | PAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMILSMMDR |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MRD21; FAP108; CFAP108; CTCF |
| Calculated MW | 83kDa |
| Observed MW | 140kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence Immunoprecipitation |
| Positive samples | Jurkat, HeLa, Mouse lung, 293T |
| Cellular location | Chromosome, Nucleus, centromere, nucleoplasm. |
| Customer validation | IP(Mus musculus) WB(Mus musculus) WB(Homo sapiens) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19588? Please let us know so that we can cite the reference in this datasheet.
