Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | CXCR2 Rabbit pAb |
---|---|
Catalog No. | A3301 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 260-359 of human CXCR2 (NP_001548.1). |
---|---|
Sequence | FLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTT |
Gene ID | |
Swiss Prot | |
Synonyms | CD182; IL8R2; IL8RA; IL8RB; CMKAR2; WHIMS2; CDw128b; CXCR2 |
Calculated MW | 41kDa |
Observed MW | 46kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | THP-1, Mouse lung, Mouse brain, Mouse spleen, Rat lung, Rat brain, Rat spleen |
Cellular location | Cell membrane, Multi-pass membrane protein. |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Homo sapiens) IF(Mus musculus) IP(Rattus norvegicus) IHC(Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3301? Please let us know so that we can cite the reference in this datasheet.